PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 337aa    MW: 33712.3 Da    PI: 9.8849
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017432.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38.1e-3944104262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  Do017432.1  44 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 104
                 56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3828102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60948102IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3248102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MASIVAAASG GGGGGAGGRG PTGGSAVRPG SMTERARLEK IPQPEPGLKC PRCESTNTKF  60
CYFNNYSLSQ PRHFCKTCRR YWTRGGALRN VPVGGGCRRN KRTKSSKSNS SSAASASTTG  120
GTSSSTSSTA TGGSSAAAAA AGIMPPQGQL PFLASLHHPL GGDHYSTGAS RLGFAGLSSL  180
DPVDYQLGAS GATGTAIGLE QWRLPQIQQF PFLSRPDAVP PPMSGIYPFD VETHGDAAGF  240
AGQMLGGSKV PGSAGLITQL ASVKMEDNPP SAALTSSPRE FLGLPGNLQF WGGGNGASGN  300
NGGNANNAGS GGGGAAAPGS SWVDLSGFNS SSSGNIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824010.0KC582401.1 Sorghum bicolor dof4 protein (dof4) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981250.11e-147PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4AAI91e-147K4AAI9_SETIT; Uncharacterized protein
STRINGSi035896m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.23e-44OBF-binding protein 3